(data stored in ACNUC7421 zone)

EMBL: CP001743.PE201

CP001743.PE201       Location/Qualifiers
FT   CDS             176028..177125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0203"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; PRIAM: Alanine racemase;
FT                   PFAM: alanine racemase domain protein; InterPro
FT                   IPR000821:IPR011079:IPR001608; KEGG: bcy:Bcer98_1563
FT                   alanine racemase; COGs: COG0787 Alanine racemase; SPTR:
FT                   Q8ELK1 Alanine racemase 2; PFAM: Alanine racemase,
FT                   N-terminal domain; Alanine racemase, C-terminal domain;
FT                   TIGRFAM: alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26983"
FT                   /protein_id="ADD26983.1"
FT                   /translation="MRPAWLEINLDALAHNYNLLRSRAGNTQVIGVVKANAYGHGAVEV
FT                   GKELLRLGAWGLAVATTDEARELRKAGIVARILLMGSLHPQQAREVVELDLIPSISTLE
FT                   SAEALNALGKPVTVHLEFDTGMGRVGFQPEEAPQVKEHLVRYENLLVQGIYSHFADAEE
FT                   DVLWTKEQIAHFKQVQQVFGPGYFYHLCNTAGTFNFGEYGLSAVRPGIGLYGLLPHLGL
FT                   KPIARLLAKPTQVKELPPGRRIGYSGLYTTQGREWIATLPVGYADGIPRLVFNRATVRY
FT                   YPDDQPCTCPVVGRVSMDQITVKLPGPVGLEQVFEVVTPDFDPTSSLWGWAELTGTVSY
FT                   EPAVRLAARLPRVYLRDGTEVARVG"
     MRPAWLEINL DALAHNYNLL RSRAGNTQVI GVVKANAYGH GAVEVGKELL RLGAWGLAVA        60
     TTDEARELRK AGIVARILLM GSLHPQQARE VVELDLIPSI STLESAEALN ALGKPVTVHL       120
     EFDTGMGRVG FQPEEAPQVK EHLVRYENLL VQGIYSHFAD AEEDVLWTKE QIAHFKQVQQ       180
     VFGPGYFYHL CNTAGTFNFG EYGLSAVRPG IGLYGLLPHL GLKPIARLLA KPTQVKELPP       240
     GRRIGYSGLY TTQGREWIAT LPVGYADGIP RLVFNRATVR YYPDDQPCTC PVVGRVSMDQ       300
     ITVKLPGPVG LEQVFEVVTP DFDPTSSLWG WAELTGTVSY EPAVRLAARL PRVYLRDGTE       360
     VARVG                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page