(data stored in ACNUC7421 zone)

EMBL: CP001743.PE203

CP001743.PE203       Location/Qualifiers
FT   CDS             complement(177510..178103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0205"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="SPTR: A0YAV8 Acetyltransferase, GNAT family protein;
FT                   COGs: COG1670 Acetyltransferase including N-acetylase of
FT                   ribosomal protein; KEGG: mxa:MXAN_1062 acetyltransferase,
FT                   GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26985"
FT                   /protein_id="ADD26985.1"
FT                   /translation="MVVLGYMWHDCPILEGLYIRLEPLRLEHAPALLEHYDAEMVQYLS
FT                   NAPREATLEAMQNYIRSLLSAKDRVNWVIVDRASGQMAGRTGYVRINPEYRGLETTTWI
FT                   FTPFQGGYANPESKYLLLCRAFEDLKAIRVQFRADARNTRSCKAIEKLGATFEGILRKD
FT                   QIYPNGTIRNTAVYSIIDDEWPQVKKGLEARLYR"
     MVVLGYMWHD CPILEGLYIR LEPLRLEHAP ALLEHYDAEM VQYLSNAPRE ATLEAMQNYI        60
     RSLLSAKDRV NWVIVDRASG QMAGRTGYVR INPEYRGLET TTWIFTPFQG GYANPESKYL       120
     LLCRAFEDLK AIRVQFRADA RNTRSCKAIE KLGATFEGIL RKDQIYPNGT IRNTAVYSII       180
     DDEWPQVKKG LEARLYR                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page