(data stored in ACNUC7421 zone)

EMBL: CP001743.PE204

CP001743.PE204       Location/Qualifiers
FT   CDS             178128..178634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0206"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; InterPro
FT                   IPR001453; KEGG: molybdenum cofactor synthesis domain
FT                   protein; COGs: COG0521 Molybdopterin biosynthesis protein;
FT                   SPTR: B2YI79 Molybdopterin biosynthesis enzyme; PFAM:
FT                   Probable molybdopterin binding domain; TIGRFAM: molybdenum
FT                   cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26986"
FT                   /protein_id="ADD26986.1"
FT                   /translation="MIRVGILTISDREARGESEDHAYAALRESLALGPYEIANYEIIPD
FT                   EPAQIKRVLRLWADRDGLDVILTLGSIRLSNRDHAPEATREMLEKEAPGIAELIRMETY
FT                   KKNPLAALSRGVAGVRGKTLIINLPGGPQGSKDSLEVILPLIPEAVQRITGRPVAHLAN
FT                   GFSFD"
     MIRVGILTIS DREARGESED HAYAALRESL ALGPYEIANY EIIPDEPAQI KRVLRLWADR        60
     DGLDVILTLG SIRLSNRDHA PEATREMLEK EAPGIAELIR METYKKNPLA ALSRGVAGVR       120
     GKTLIINLPG GPQGSKDSLE VILPLIPEAV QRITGRPVAH LANGFSFD                    168
//

If you have problems or comments...

PBIL Back to PBIL home page