(data stored in ACNUC7421 zone)

EMBL: CP001743.PE207

CP001743.PE207       Location/Qualifiers
FT   CDS             complement(181443..182615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0209"
FT                   /product="Threonyl/alanyl tRNA synthetase SAD"
FT                   /note="PFAM: Threonyl/alanyl tRNA synthetase SAD; SPTR:
FT                   A6BHW2 Putative uncharacterized protein; InterPro
FT                   IPR012947:IPR002318; COGs: COG2872 metal-dependent
FT                   hydrolase related to alanyl-tRNA synthetase HxxxH domain;
FT                   KEGG: sus:Acid_1476 alanyl-tRNA synthetase; PFAM: Threonyl
FT                   and Alanyl tRNA synthetase second additional domain; tRNA
FT                   synthetases class II (A)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26989"
FT                   /protein_id="ADD26989.1"
FT                   /translation="MRAYWDHPYESQFEAQVVRAWSEGGKHFAVLDQTLFYPTSGGQAC
FT                   DTGHLGGVAVLEVLEDAKATGPVIHRLESPLLEGQRVVGQLDWARRYRHMQRHTAEHML
FT                   GQAFLRAAGWNVVAVNMSNPVCTMDFDGPPDEAVIRQAEALANWAVYANTAVRTYFIND
FT                   AEAPAHGLRRAPKVAGLIRVVEIEGWDRVACGGLHVARTGEAGPIKITRFERYKGGTRV
FT                   YFMAGWEALELFEQEHRLLARLGEWFSSSPLEVEKPIGNLREEWRRARAENAALKDELA
FT                   ERIMRDLLTEFPTQTMAAQVPHSVLDMVGKRLAEWPGVLALLVAQAEDKARYVLLKHPS
FT                   RSEDLQAIWEEVLKPLGARGGGALVKLGVMPLKSLHPALLAFQRYLAQER"
     MRAYWDHPYE SQFEAQVVRA WSEGGKHFAV LDQTLFYPTS GGQACDTGHL GGVAVLEVLE        60
     DAKATGPVIH RLESPLLEGQ RVVGQLDWAR RYRHMQRHTA EHMLGQAFLR AAGWNVVAVN       120
     MSNPVCTMDF DGPPDEAVIR QAEALANWAV YANTAVRTYF INDAEAPAHG LRRAPKVAGL       180
     IRVVEIEGWD RVACGGLHVA RTGEAGPIKI TRFERYKGGT RVYFMAGWEA LELFEQEHRL       240
     LARLGEWFSS SPLEVEKPIG NLREEWRRAR AENAALKDEL AERIMRDLLT EFPTQTMAAQ       300
     VPHSVLDMVG KRLAEWPGVL ALLVAQAEDK ARYVLLKHPS RSEDLQAIWE EVLKPLGARG       360
     GGALVKLGVM PLKSLHPALL AFQRYLAQER                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page