(data stored in ACNUC7421 zone)

EMBL: CP001743.PE209

CP001743.PE209       Location/Qualifiers
FT   CDS             184801..186666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0211"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; InterPro IPR001023:IPR013126:IPR012725; KEGG:
FT                   Hsp70-type chaperone; COGs: COG0443 Molecular chaperone;
FT                   SPTR: Q72IK5 Chaperone protein dnaK; PFAM: Hsp70 protein;
FT                   TIGRFAM: chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26991"
FT                   /protein_id="ADD26991.1"
FT                   /translation="MAKAVGIDLGTTNSVIAIMEGGSPVVLENAEGERTTPSVVAYKGS
FT                   DQLVGRVARRQAVLNPEGTVFEIKRFIGRRWEEVQDEVKRVPYKVVKGPDGGVRVDIAG
FT                   KLYTPEEISAMILRKLVDDASKKLGEKITKAVITVPAYFNNAQREATANAGRIAGLEVL
FT                   RIVNEPTAAALAYGLDKKGHETVLVFDLGGGTFDVTVLEIGDGVFEVKATAGDTHLGGS
FT                   DFDHAIVNWLAEEFKKESGGVDLKADRQALQRLIEAAEKAKIELSAVTETTISLPFIGL
FT                   DPISKTPLHLERKLTRAKFEELIQPLLKKIRGPVEQALRDAGLSASQIDEVLLVGGSTR
FT                   VPAVQQIVKEMLGKEPNRSVNPDEVVALGAAVQAGVLTGQVEDVVLLDVTPLSLGVETK
FT                   GGVFTVLIPRNTTVPTRKSEIFTTAEHNQPSVEIHVLQGERPMAADNKSLGRFRLDGIP
FT                   PMPAGVPQIEVTFDIDANGILHATAKEKSTGKEASITIQNTTTLSEQEIERMIKEAEAN
FT                   AEADRKRKEHADLKNNLDAARIQAERVMGEKESTAEAKSRLEAAISRAKTLVDTDGSDA
FT                   DLRQATEELLAALQAYEQGAAAGSQAQSSTPKSDDVIDADYKPAD"
     MAKAVGIDLG TTNSVIAIME GGSPVVLENA EGERTTPSVV AYKGSDQLVG RVARRQAVLN        60
     PEGTVFEIKR FIGRRWEEVQ DEVKRVPYKV VKGPDGGVRV DIAGKLYTPE EISAMILRKL       120
     VDDASKKLGE KITKAVITVP AYFNNAQREA TANAGRIAGL EVLRIVNEPT AAALAYGLDK       180
     KGHETVLVFD LGGGTFDVTV LEIGDGVFEV KATAGDTHLG GSDFDHAIVN WLAEEFKKES       240
     GGVDLKADRQ ALQRLIEAAE KAKIELSAVT ETTISLPFIG LDPISKTPLH LERKLTRAKF       300
     EELIQPLLKK IRGPVEQALR DAGLSASQID EVLLVGGSTR VPAVQQIVKE MLGKEPNRSV       360
     NPDEVVALGA AVQAGVLTGQ VEDVVLLDVT PLSLGVETKG GVFTVLIPRN TTVPTRKSEI       420
     FTTAEHNQPS VEIHVLQGER PMAADNKSLG RFRLDGIPPM PAGVPQIEVT FDIDANGILH       480
     ATAKEKSTGK EASITIQNTT TLSEQEIERM IKEAEANAEA DRKRKEHADL KNNLDAARIQ       540
     AERVMGEKES TAEAKSRLEA AISRAKTLVD TDGSDADLRQ ATEELLAALQ AYEQGAAAGS       600
     QAQSSTPKSD DVIDADYKPA D                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page