(data stored in ACNUC7421 zone)

EMBL: CP001743.PE21

CP001743.PE21        Location/Qualifiers
FT   CDS             18965..19642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0021"
FT                   /product="glutaredoxin-like domain protein"
FT                   /note="TIGRFAM: glutaredoxin-like domain protein; COGs:
FT                   COG3634 Alkyl hydroperoxide reductase large subunit; KEGG:
FT                   ank:AnaeK_2804 glutaredoxin-like domain protein; SPTR:
FT                   B5IAV2 Glutaredoxin-like domain protein; InterPro
FT                   IPR011903; TIGRFAM: Glutaredoxin-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26803"
FT                   /protein_id="ADD26803.1"
FT                   /translation="MFLDEKIQAQVREMLAPIQTPVEVVVFTTAGLELPGQEVGLQDET
FT                   LGLLKEVVALNPHLSLEQRSIHSDPEAQALGLRYAPTILLREKGSNRNNIRFLGLPAGY
FT                   EFSTLIETLLMLGTGESKLGEKSQADLQKVASPVRMQAFVTPTCPYCPQAVLATYKLAY
FT                   HNPNIIAEGVEASEFPLLSRRYNISGVPDTIISGATQQRILGGQPDRVFVEAAIKASAG
FT                   VVV"
     MFLDEKIQAQ VREMLAPIQT PVEVVVFTTA GLELPGQEVG LQDETLGLLK EVVALNPHLS        60
     LEQRSIHSDP EAQALGLRYA PTILLREKGS NRNNIRFLGL PAGYEFSTLI ETLLMLGTGE       120
     SKLGEKSQAD LQKVASPVRM QAFVTPTCPY CPQAVLATYK LAYHNPNIIA EGVEASEFPL       180
     LSRRYNISGV PDTIISGATQ QRILGGQPDR VFVEAAIKAS AGVVV                       225
//

If you have problems or comments...

PBIL Back to PBIL home page