(data stored in ACNUC7421 zone)

EMBL: CP001743.PE210

CP001743.PE210       Location/Qualifiers
FT   CDS             186745..187299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0212"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; SPTR: Q8L2F3 Protein grpE;
FT                   InterPro IPR000740; COGs: COG0576 Molecular chaperone GrpE
FT                   (heat shock protein); KEGG: Os02g0612000; hypothetical
FT                   protein; K03687 molecular chaperone GrpE; PFAM: GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26992"
FT                   /protein_id="ADD26992.1"
FT                   /translation="MENNEPVVETPEAQNDLPEVERLKGEVEFLKAELEASKNKFLRLY
FT                   ADFENYKKRMVQELEAAQRNGKFDAVRALLGTLDDLERALGFASVKPEDLIPGVRSVLE
FT                   NFTRSLKSLGVEAVPGVGAEFDPRYHEAIGAVEGEEGKVMHVYQQGFKYGDLLVRPARV
FT                   VVGSGAKPEEAEGPKPSAESN"
     MENNEPVVET PEAQNDLPEV ERLKGEVEFL KAELEASKNK FLRLYADFEN YKKRMVQELE        60
     AAQRNGKFDA VRALLGTLDD LERALGFASV KPEDLIPGVR SVLENFTRSL KSLGVEAVPG       120
     VGAEFDPRYH EAIGAVEGEE GKVMHVYQQG FKYGDLLVRP ARVVVGSGAK PEEAEGPKPS       180
     AESN                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page