(data stored in ACNUC7421 zone)

EMBL: CP001743.PE211

CP001743.PE211       Location/Qualifiers
FT   CDS             187355..188230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0213"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: chaperone DnaJ domain protein; heat shock
FT                   protein DnaJ domain protein; SMART: heat shock protein DnaJ
FT                   domain protein; InterPro IPR003095:IPR002939:IPR001623;
FT                   KEGG: afr:AFE_3102 curved DNA-binding protein; COGs:
FT                   COG0484 DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain; SPTR: Q56237 Chaperone protein dnaJ 2; PFAM:
FT                   DnaJ C terminal region; DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26993"
FT                   /protein_id="ADD26993.1"
FT                   /translation="MAYKDYYKILGVPKNASEDEIKKAFKKLARKYHPDVNKEPGAEEK
FT                   FKEINEAYTVLSDPEKRRYYDTYGAAAGSAGWQGPPPGPGGFGGFTGNVGDFSDFFQQL
FT                   FGGRGGFGGLGDLFEQTPGRGARRVAGDLEAELPLSLEEAYRGGEKTISVGAERLTVRI
FT                   PPGVREGQKIRLAGKGRAGGDLYLHVKLQSRPEMRLEGDDIYTVVEVPAPIAVVGGKVR
FT                   VQTLDGPVEITIPRRTQAGRKLRLAGKGWPRKDKSRGDQYAEVRVTIPTNPSPEEERLY
FT                   AQLAELIKVQ"
     MAYKDYYKIL GVPKNASEDE IKKAFKKLAR KYHPDVNKEP GAEEKFKEIN EAYTVLSDPE        60
     KRRYYDTYGA AAGSAGWQGP PPGPGGFGGF TGNVGDFSDF FQQLFGGRGG FGGLGDLFEQ       120
     TPGRGARRVA GDLEAELPLS LEEAYRGGEK TISVGAERLT VRIPPGVREG QKIRLAGKGR       180
     AGGDLYLHVK LQSRPEMRLE GDDIYTVVEV PAPIAVVGGK VRVQTLDGPV EITIPRRTQA       240
     GRKLRLAGKG WPRKDKSRGD QYAEVRVTIP TNPSPEEERL YAQLAELIKV Q                291
//

If you have problems or comments...

PBIL Back to PBIL home page