(data stored in ACNUC7421 zone)

EMBL: CP001743.PE212

CP001743.PE212       Location/Qualifiers
FT   CDS             188254..188799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: acb:A1S_3013 hypothetical protein; SPTR:
FT                   A6EIW0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26994"
FT                   /protein_id="ADD26994.1"
FT                   /translation="MTPQQRDDLLRLLKNRFEQHPHRHPGLRWADLEARLLAQPDKLAS
FT                   LLEMENTGGEPDVVGRDPQTGTFIFFDCAPESPKGRRSLCYDQAARLARKQNRPASSAL
FT                   EMAAAMGIELLTEEQYQALQQLGRFDTKTSSWLKTPEAIRKLGGAIFGDRRYDRVFIYH
FT                   NGADSYYAARGFRGCLRV"
     MTPQQRDDLL RLLKNRFEQH PHRHPGLRWA DLEARLLAQP DKLASLLEME NTGGEPDVVG        60
     RDPQTGTFIF FDCAPESPKG RRSLCYDQAA RLARKQNRPA SSALEMAAAM GIELLTEEQY       120
     QALQQLGRFD TKTSSWLKTP EAIRKLGGAI FGDRRYDRVF IYHNGADSYY AARGFRGCLR       180
     V                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page