(data stored in ACNUC7421 zone)

EMBL: CP001743.PE213

CP001743.PE213       Location/Qualifiers
FT   CDS             189113..191533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0215"
FT                   /product="CRISPR-associated protein, Csm1 family"
FT                   /note="KEGG: sfu:Sfum_1349 CRISPR-associated protein, Csm1
FT                   family; COGs: COG1353 hydrolase of the HD superfamily
FT                   (permuted catalytic motifs); SPTR: A4KK95 Putative
FT                   uncharacterized protein; TIGRFAM: CRISPR-associated
FT                   protein, Csm1 family; InterPro IPR000160:IPR013408; PFAM:
FT                   HD domain; TIGRFAM: CRISPR-associated protein, Csm1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26995"
FT                   /protein_id="ADD26995.1"
FT                   /translation="MSDPANIALAALLHDLGKLYQRAYWGHAPEGVSDWSHPAYTEWAI
FT                   RQHRRLFEQAGLEPDWLAQTAARHHEGWSNKPQYQPQTPEGWCVALADTYASRERLEVD
FT                   EKGSRAPDTPLKSVFANLRVQETYGQRDHGYSMVEAGREVGLKLGGAYPQARPNVSRDT
FT                   YWRLAERLDGRLTELAKHSLGPEALLMNLLGIFQELLWNVPSDTQGEPDVSLFDHLRLT
FT                   GAIAAALWAYHDGKATVEALRDETPEKFLLVLGDLGGIQGHIYRIQGAQTGVGGLAKRL
FT                   RARSLEVSLAAEALGLELLQRTGFTPLQRIMSAGGKFYLLLPNTEAVHRALDAVRQGWE
FT                   AWALQQGATLLPFLAAHPFAPGGFRAFSEVLKAAHQKLVEAKLKPLSSQLSTPYLTSGS
FT                   TSLRPCRACGVRPAQSATDELCHGCERDGHMGRLIPKRTEIGFFPQDAPRPHYRFPAWQ
FT                   VALEASPAHTLRTRPDFTPAAHPWEVRLLAGHIPTLADALRQGRWRDLAEYQAWAKEQG
FT                   LWEEEEEGRKADDPLTLAELAEFSTGAKYLGALMLDADRMGEAFATGFKDEEGQDSSSP
FT                   SRIASLSRMLELFFAGEVLELIKNPQTYAKRLGWDELKAREKAARYPLIYSVYAGGDDL
FT                   FLLGPWDVLLEFALDLQALYREFTQHPALTLSGGFVLVSPSLPIPLLAEAVQEAEQAAK
FT                   NAGRNRLHLFGQGVPWDELRNLLPWVRDFRRHLEAEGKAGLSSALAYRLLRLWRGHQDE
FT                   DEARRMRYKPLLAYALRERNEEIRKHYLQLTDHTQAAWQYLPVWVQWGLYLER"
     MSDPANIALA ALLHDLGKLY QRAYWGHAPE GVSDWSHPAY TEWAIRQHRR LFEQAGLEPD        60
     WLAQTAARHH EGWSNKPQYQ PQTPEGWCVA LADTYASRER LEVDEKGSRA PDTPLKSVFA       120
     NLRVQETYGQ RDHGYSMVEA GREVGLKLGG AYPQARPNVS RDTYWRLAER LDGRLTELAK       180
     HSLGPEALLM NLLGIFQELL WNVPSDTQGE PDVSLFDHLR LTGAIAAALW AYHDGKATVE       240
     ALRDETPEKF LLVLGDLGGI QGHIYRIQGA QTGVGGLAKR LRARSLEVSL AAEALGLELL       300
     QRTGFTPLQR IMSAGGKFYL LLPNTEAVHR ALDAVRQGWE AWALQQGATL LPFLAAHPFA       360
     PGGFRAFSEV LKAAHQKLVE AKLKPLSSQL STPYLTSGST SLRPCRACGV RPAQSATDEL       420
     CHGCERDGHM GRLIPKRTEI GFFPQDAPRP HYRFPAWQVA LEASPAHTLR TRPDFTPAAH       480
     PWEVRLLAGH IPTLADALRQ GRWRDLAEYQ AWAKEQGLWE EEEEGRKADD PLTLAELAEF       540
     STGAKYLGAL MLDADRMGEA FATGFKDEEG QDSSSPSRIA SLSRMLELFF AGEVLELIKN       600
     PQTYAKRLGW DELKAREKAA RYPLIYSVYA GGDDLFLLGP WDVLLEFALD LQALYREFTQ       660
     HPALTLSGGF VLVSPSLPIP LLAEAVQEAE QAAKNAGRNR LHLFGQGVPW DELRNLLPWV       720
     RDFRRHLEAE GKAGLSSALA YRLLRLWRGH QDEDEARRMR YKPLLAYALR ERNEEIRKHY       780
     LQLTDHTQAA WQYLPVWVQW GLYLER                                            806
//

If you have problems or comments...

PBIL Back to PBIL home page