(data stored in ACNUC7421 zone)

EMBL: CP001743.PE215

CP001743.PE215       Location/Qualifiers
FT   CDS             192026..192700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0217"
FT                   /product="CRISPR-associated RAMP protein, Csm3 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm3
FT                   family; PFAM: protein of unknown function DUF324; InterPro
FT                   IPR005537:IPR013412; KEGG: dol:Dole_0742 CRISPR-associated
FT                   RAMP Csm3 family protein; COGs: COG1337 Uncharacterized
FT                   protein predicted to be involved in DNA repair (RAMP
FT                   superfamily); SPTR: Q8TPH9 Putative uncharacterized
FT                   protein; PFAM: RAMP superfamily; TIGRFAM: CRISPR-associated
FT                   RAMP protein, Csm3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26997"
FT                   /protein_id="ADD26997.1"
FT                   /translation="MKLLGYKRIHGIIHLRSGLRIGMSKDQMAIGDVDNPVIRNPLTDE
FT                   PYIPGSSLKGKMRYLLEWHLGGKYITESDQYHVYKDEDGPIGRIFGVAPGNDRRSKELA
FT                   QQRGPTRLLVRDAYLTRESKERLEAMTARGGYLTEVKQEVFIPRIGGNANPRTAERVPA
FT                   GAKFAFEMVYRVMDTGDGGQTDQSNFEYVKKALELLQLDGLGGYISRGYGQVELRYEVE
FT                   EK"
     MKLLGYKRIH GIIHLRSGLR IGMSKDQMAI GDVDNPVIRN PLTDEPYIPG SSLKGKMRYL        60
     LEWHLGGKYI TESDQYHVYK DEDGPIGRIF GVAPGNDRRS KELAQQRGPT RLLVRDAYLT       120
     RESKERLEAM TARGGYLTEV KQEVFIPRIG GNANPRTAER VPAGAKFAFE MVYRVMDTGD       180
     GGQTDQSNFE YVKKALELLQ LDGLGGYISR GYGQVELRYE VEEK                        224
//

If you have problems or comments...

PBIL Back to PBIL home page