(data stored in ACNUC7421 zone)

EMBL: CP001743.PE219

CP001743.PE219       Location/Qualifiers
FT   CDS             195009..195389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0221"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SPTR: A3Z442
FT                   Putative uncharacterized protein; InterPro IPR002716; COGs:
FT                   COG3742 conserved hypothetical protein; KEGG: nha:Nham_4577
FT                   PilT protein-like; PFAM: PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27001"
FT                   /protein_id="ADD27001.1"
FT                   /translation="MVLDSSVLVQLIFAEPGHRETLEHILEAEVRVVGAPTLVEVGMVL
FT                   TSRLGPDNLYLLDELLMRLEARVVPFEASHAHQALSAFRRCGKGRHPAALNFGDCLSYA
FT                   VAKVAGMPLAYVGDDFAQTDLA"
     MVLDSSVLVQ LIFAEPGHRE TLEHILEAEV RVVGAPTLVE VGMVLTSRLG PDNLYLLDEL        60
     LMRLEARVVP FEASHAHQAL SAFRRCGKGR HPAALNFGDC LSYAVAKVAG MPLAYVGDDF       120
     AQTDLA                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page