(data stored in ACNUC7421 zone)

EMBL: CP001743.PE222

CP001743.PE222       Location/Qualifiers
FT   CDS             197591..198562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0224"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; InterPro IPR002729;
FT                   KEGG: msu:MS0981 hypothetical protein; COGs: COG1518
FT                   Uncharacterized protein predicted to be involved in DNA
FT                   repair; SPTR: A1HM55 CRISPR-associated protein Cas1; PFAM:
FT                   Protein of unknown function DUF48; TIGRFAM:
FT                   CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27004"
FT                   /protein_id="ADD27004.1"
FT                   /translation="MTLHLTEQSSTLRLSQGRLRVELDEQTLAELPARKVRGVVVWGNV
FT                   RLTTPALAFLLRQGVPVLYATLEGQLYGQAQAPQSLAPEVLRAQLLAQQNPLPLAQGFL
FT                   LGKLRSGQMLLERLARQAPITPQQAEIEAALEALPQARSLEALRGIEGNAARAYFAGLQ
FT                   AVLAPYGFSGRNRRPPTDAVNAALSYGYMVLLGRVLLALGIAGLHPELGLLHTEGRRVP
FT                   ALAFDLMEEFRVSVVDAVVIAAFLRSELTPQQHSEARNGGVYLNEAGRKALLRRLEERF
FT                   SQEAQHPKGFRKPYQELIETQAARLKAAILGREPYTPFYLWR"
     MTLHLTEQSS TLRLSQGRLR VELDEQTLAE LPARKVRGVV VWGNVRLTTP ALAFLLRQGV        60
     PVLYATLEGQ LYGQAQAPQS LAPEVLRAQL LAQQNPLPLA QGFLLGKLRS GQMLLERLAR       120
     QAPITPQQAE IEAALEALPQ ARSLEALRGI EGNAARAYFA GLQAVLAPYG FSGRNRRPPT       180
     DAVNAALSYG YMVLLGRVLL ALGIAGLHPE LGLLHTEGRR VPALAFDLME EFRVSVVDAV       240
     VIAAFLRSEL TPQQHSEARN GGVYLNEAGR KALLRRLEER FSQEAQHPKG FRKPYQELIE       300
     TQAARLKAAI LGREPYTPFY LWR                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page