(data stored in ACNUC7421 zone)

EMBL: CP001743.PE226

CP001743.PE226       Location/Qualifiers
FT   CDS             201749..202630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0229"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; SPTR: A6C0M4
FT                   Periplasmic binding protein; InterPro IPR002491; COGs:
FT                   COG0614 ABC-type Fe3+-hydroxamate transport system
FT                   periplasmic component; KEGG: rfr:Rfer_2621 periplasmic
FT                   binding protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27008"
FT                   /protein_id="ADD27008.1"
FT                   /translation="MKRSFWLLLLALSFALLAPGLAQPFPRTLTDDLGRSITLKAAPQR
FT                   IVALLPSVTETVCALNACGRLVGVDDYSDFPEQVKRLPKVGGLYNPNLEAILALKPDLV
FT                   IVSVYGKLHEGLERAGVASFAVKPETYDDIFRTTRLLGRVLGLEAQAERLVAQIQREVY
FT                   AVESRAAKAAQRPTVYYEIDPTPYTVGPESFIGVLITKARGQNIVPRELGLFPQISPEL
FT                   VVQKNPAVIVLTHPGAADLPKRPGWAGVAAIRNQRICTFTGQQDNLLSRPGPRVAQGLQ
FT                   LLVGCFHPELRR"
     MKRSFWLLLL ALSFALLAPG LAQPFPRTLT DDLGRSITLK AAPQRIVALL PSVTETVCAL        60
     NACGRLVGVD DYSDFPEQVK RLPKVGGLYN PNLEAILALK PDLVIVSVYG KLHEGLERAG       120
     VASFAVKPET YDDIFRTTRL LGRVLGLEAQ AERLVAQIQR EVYAVESRAA KAAQRPTVYY       180
     EIDPTPYTVG PESFIGVLIT KARGQNIVPR ELGLFPQISP ELVVQKNPAV IVLTHPGAAD       240
     LPKRPGWAGV AAIRNQRICT FTGQQDNLLS RPGPRVAQGL QLLVGCFHPE LRR              293
//

If you have problems or comments...

PBIL Back to PBIL home page