(data stored in ACNUC7421 zone)

EMBL: CP001743.PE227

CP001743.PE227       Location/Qualifiers
FT   CDS             202639..203697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0230"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; SPTR: A8CQL2 Transport system permease protein;
FT                   InterPro IPR000522:IPR001626; COGs: COG0609 ABC-type
FT                   Fe3+-siderophore transport system permease component; KEGG:
FT                   dac:Daci_2793 transport system permease protein; PFAM:
FT                   FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27009"
FT                   /protein_id="ADD27009.1"
FT                   /translation="MHTPALTTPKRRVAAGLLPRLSAFAALLVLLGLGGLLGLWYGAVQ
FT                   IPAQEVLRALLGWQDNPIITELRLPRVLGAILVGAALGLSGAAFQGLFRNPLADPYLMG
FT                   SAAGAAFGVTLAVSLAGGLSGAFAQHAIFGFLPSSATWFGFLGAVGAVLLVLLLSGGAS
FT                   RTHDLILAGVVVGSILVGLTSYLMLQDADRVRAVFAYTLGNLAFISWQGVGSLAGYLLL
FT                   TLPVFLLLGRTLNALTLGEETARSLGLPLEGLKLLLIGVCTLLTAAAVAQAGIIGFVGL
FT                   VAPHVLRRLLGGDYRYLLPASALGGAVLLLWADLGARVLVAPAELPVGIVTTLLGGPFF
FT                   LYLLWRERRRYG"
     MHTPALTTPK RRVAAGLLPR LSAFAALLVL LGLGGLLGLW YGAVQIPAQE VLRALLGWQD        60
     NPIITELRLP RVLGAILVGA ALGLSGAAFQ GLFRNPLADP YLMGSAAGAA FGVTLAVSLA       120
     GGLSGAFAQH AIFGFLPSSA TWFGFLGAVG AVLLVLLLSG GASRTHDLIL AGVVVGSILV       180
     GLTSYLMLQD ADRVRAVFAY TLGNLAFISW QGVGSLAGYL LLTLPVFLLL GRTLNALTLG       240
     EETARSLGLP LEGLKLLLIG VCTLLTAAAV AQAGIIGFVG LVAPHVLRRL LGGDYRYLLP       300
     ASALGGAVLL LWADLGARVL VAPAELPVGI VTTLLGGPFF LYLLWRERRR YG               352
//

If you have problems or comments...

PBIL Back to PBIL home page