(data stored in ACNUC7421 zone)

EMBL: CP001743.PE23

CP001743.PE23        Location/Qualifiers
FT   CDS             20021..20308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0023"
FT                   /product="protein of unknown function DUF156"
FT                   /note="COGs: COG1937 conserved hypothetical protein; KEGG:
FT                   pzu:PHZ_c1054 hypothetical protein; SPTR: A1BZQ7 Putative
FT                   uncharacterized protein; PFAM: protein of unknown function
FT                   DUF156; InterPro IPR003735; PFAM: Uncharacterised BCR,
FT                   COG1937"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26805"
FT                   /protein_id="ADD26805.1"
FT                   /translation="MTTVPEAPPNLRFDVQDKTRIIHRLRRLEGQVRGLQKMVEEDREC
FT                   REILTLLSGVKRALDSVGEEILEAYLARCQAGPGQPQPAQVIEVVRLLRK"
     MTTVPEAPPN LRFDVQDKTR IIHRLRRLEG QVRGLQKMVE EDRECREILT LLSGVKRALD        60
     SVGEEILEAY LARCQAGPGQ PQPAQVIEVV RLLRK                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page