(data stored in ACNUC7421 zone)

EMBL: CP001743.PE232

CP001743.PE232       Location/Qualifiers
FT   CDS             206227..206736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0235"
FT                   /product="Adenosylcobinamide-phosphateguanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /note="PRIAM: Adenosylcobinamide-phosphate
FT                   guanylyltransferase; PFAM: cobalbumin biosynthesis protein;
FT                   InterPro IPR003203; KEGG: nar:Saro_0322 adenosylcobinamide
FT                   kinase; COGs: COG2087 Adenosyl cobinamide kinase/adenosyl
FT                   cobinamide phosphate guanylyltransferase; SPTR: A1HPW6
FT                   Adenosylcobinamide-phosphate guanylyltransferase; PFAM:
FT                   Cobinamide kinase / cobinamide phosphate guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27014"
FT                   /protein_id="ADD27014.1"
FT                   /translation="MQKHLVLITGGARAGKSRFAQAQAQALGQAQVSFIATAEPLDGEM
FT                   RQRIAKHRAERPPAWETLEAPLEVPQALQQARHGVVLLDCLTLWVSNLMLAGLEVLPAL
FT                   ERLLAVWAQSDKTLLVVTNEVGLGIVPENPLARRYRDLLGAANARVAQEAHRVYLLVAG
FT                   IPLQIK"
     MQKHLVLITG GARAGKSRFA QAQAQALGQA QVSFIATAEP LDGEMRQRIA KHRAERPPAW        60
     ETLEAPLEVP QALQQARHGV VLLDCLTLWV SNLMLAGLEV LPALERLLAV WAQSDKTLLV       120
     VTNEVGLGIV PENPLARRYR DLLGAANARV AQEAHRVYLL VAGIPLQIK                   169
//

If you have problems or comments...

PBIL Back to PBIL home page