(data stored in ACNUC7421 zone)

EMBL: CP001743.PE239

CP001743.PE239       Location/Qualifiers
FT   CDS             complement(212696..213985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0243"
FT                   /product="Cytochrome b/b6 domain protein"
FT                   /note="PFAM: Cytochrome b/b6 domain; SPTR: Q703H8
FT                   Cytochrome b; InterPro IPR005797:IPR005798; COGs: COG1290
FT                   Cytochrome b subunit of the bc complex; KEGG: gme:Gmet_1923
FT                   cytochrome b/b6-like; PFAM: Cytochrome
FT                   b(N-terminal)/b6/petB"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27021"
FT                   /protein_id="ADD27021.1"
FT                   /translation="MYQWLDDRLSIGKLYAKAFRKAFPVHHSFFLGEITLFSFVTLVLT
FT                   GIFLTLNYEPSIRPVSGSLSGGQEVPAAYYSILYIDSLPFGAVIRSLHHWAAHIMIAAA
FT                   FLHMLRIHLTGAYKNPRELNWIVGVFLLVLAIITAFTGYALPFDNYALTATKIGYEIGA
FT                   AAPWVGKLLSDILFAGELSPTNTQTIPRLFPIHVLWLPLALIALIGAHLTIMIKQKHTQ
FT                   PKYAEKVAPGKIVGVPLFPQQAAMMGILFLVYIAVTTFIAGAFLAHPVQAFGPPTANTP
FT                   AVKPDWYFMWIYGILQIIPANWRFEFLGATFGPQFWGGILVPTVIILGALAIPFLDYSK
FT                   EKQRYLELPSQHPFRTSFVVGMLMFYIMSTLAGYKVDLGLSNGLLWVLVFIVPIVTGVV
FT                   CYIIMKAIYGKDWNREPEIKLTGKGSAADD"
     MYQWLDDRLS IGKLYAKAFR KAFPVHHSFF LGEITLFSFV TLVLTGIFLT LNYEPSIRPV        60
     SGSLSGGQEV PAAYYSILYI DSLPFGAVIR SLHHWAAHIM IAAAFLHMLR IHLTGAYKNP       120
     RELNWIVGVF LLVLAIITAF TGYALPFDNY ALTATKIGYE IGAAAPWVGK LLSDILFAGE       180
     LSPTNTQTIP RLFPIHVLWL PLALIALIGA HLTIMIKQKH TQPKYAEKVA PGKIVGVPLF       240
     PQQAAMMGIL FLVYIAVTTF IAGAFLAHPV QAFGPPTANT PAVKPDWYFM WIYGILQIIP       300
     ANWRFEFLGA TFGPQFWGGI LVPTVIILGA LAIPFLDYSK EKQRYLELPS QHPFRTSFVV       360
     GMLMFYIMST LAGYKVDLGL SNGLLWVLVF IVPIVTGVVC YIIMKAIYGK DWNREPEIKL       420
     TGKGSAADD                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page