(data stored in ACNUC7421 zone)

EMBL: CP001743.PE24

CP001743.PE24        Location/Qualifiers
FT   CDS             complement(20909..22066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26806"
FT                   /protein_id="ADD26806.1"
FT                   /translation="MKVMGVHPEVGLLLLAVASGLALCWPARAEPVWRWASLGTLLWGV
FT                   QAAVWLLERQGGLEAPLTPSGVLLFAAALTWAATLRQLPLYEPPRLTLALLPFALAALV
FT                   TALSVLPNRSSQMVWLTDLLPVLLALPLLESALHGQAGESRLIWGLGLIFKAGGSWALA
FT                   LGWPPGGFVYPVWALGFVLIGWGGYLEATEARLGKGLLGFVLGGLLGSLVLLGWPSQVA
FT                   HPFHSMVLVGWGYVVLVTLGGVGWGVYQRIIKAERQLELWINLLESLSSKAQSTQNLTP
FT                   QGVLHSVMEGLQPLYGNLVGIEVRSDVTIRAGQNGPYVYTFELALDTPTEGRLYFSSAP
FT                   KDTRRLEALAPLLTERLRLSLTLNEWRSKAYTDPLTGVLSARCSA"
     MKVMGVHPEV GLLLLAVASG LALCWPARAE PVWRWASLGT LLWGVQAAVW LLERQGGLEA        60
     PLTPSGVLLF AAALTWAATL RQLPLYEPPR LTLALLPFAL AALVTALSVL PNRSSQMVWL       120
     TDLLPVLLAL PLLESALHGQ AGESRLIWGL GLIFKAGGSW ALALGWPPGG FVYPVWALGF       180
     VLIGWGGYLE ATEARLGKGL LGFVLGGLLG SLVLLGWPSQ VAHPFHSMVL VGWGYVVLVT       240
     LGGVGWGVYQ RIIKAERQLE LWINLLESLS SKAQSTQNLT PQGVLHSVME GLQPLYGNLV       300
     GIEVRSDVTI RAGQNGPYVY TFELALDTPT EGRLYFSSAP KDTRRLEALA PLLTERLRLS       360
     LTLNEWRSKA YTDPLTGVLS ARCSA                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page