(data stored in ACNUC7421 zone)

EMBL: CP001743.PE241

CP001743.PE241       Location/Qualifiers
FT   CDS             complement(214664..215155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27023"
FT                   /protein_id="ADD27023.1"
FT                   /translation="MYRNDTVVPYFALVFSAALFLMAYLNDRMRVVHEAGVVPHLTVGN
FT                   IGLMAFAMVLFIYGFIGLLSNWLEGSELRPGKHEPEPSSLPMVAGVVLSLLLVMLSGFF
FT                   VRTLVFANNPEIGYYNATTLQAGVFASMMLILALLIAIYKKYFVPEEVLAEDEKSDFPW
FT                   "
     MYRNDTVVPY FALVFSAALF LMAYLNDRMR VVHEAGVVPH LTVGNIGLMA FAMVLFIYGF        60
     IGLLSNWLEG SELRPGKHEP EPSSLPMVAG VVLSLLLVML SGFFVRTLVF ANNPEIGYYN       120
     ATTLQAGVFA SMMLILALLI AIYKKYFVPE EVLAEDEKSD FPW                         163
//

If you have problems or comments...

PBIL Back to PBIL home page