(data stored in ACNUC7421 zone)

EMBL: CP001743.PE243

CP001743.PE243       Location/Qualifiers
FT   CDS             complement(216107..216868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0247"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   SPTR: B6YWM5 Putative uncharacterized protein; InterPro
FT                   IPR012307; COGs: COG1082 Sugar phosphate
FT                   isomerase/epimerase; KEGG: gbm:Gbem_3793 xylose isomerase
FT                   domain protein TIM barrel; PFAM: Xylose isomerase-like TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27025"
FT                   /protein_id="ADD27025.1"
FT                   /translation="MKLGFSPLTAGLNYRQSFELAAELGLFLEIAFDQHEMDPRLPKAR
FT                   ELAEMGRAAGVGFTVHLPFVDWNLVSLVPEVRRLSLERTQRAIEFGAQIGAACGVLHTG
FT                   LVPLRLPEAVNHAHQLAHQALEQLELAIPVALENLGLETTDLLETPSELRNLLEAHPQY
FT                   GFCLDVGHALIQRGPTGPQEYHHLLGHRLLHLHLHDNRGIQDEHLPCGEGAVDWAWVRK
FT                   LLENFGGTAALEVSGGEGGVRRSVALLRANS"
     MKLGFSPLTA GLNYRQSFEL AAELGLFLEI AFDQHEMDPR LPKARELAEM GRAAGVGFTV        60
     HLPFVDWNLV SLVPEVRRLS LERTQRAIEF GAQIGAACGV LHTGLVPLRL PEAVNHAHQL       120
     AHQALEQLEL AIPVALENLG LETTDLLETP SELRNLLEAH PQYGFCLDVG HALIQRGPTG       180
     PQEYHHLLGH RLLHLHLHDN RGIQDEHLPC GEGAVDWAWV RKLLENFGGT AALEVSGGEG       240
     GVRRSVALLR ANS                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page