(data stored in ACNUC7421 zone)

EMBL: CP001743.PE244

CP001743.PE244       Location/Qualifiers
FT   CDS             complement(216964..218781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27026"
FT                   /protein_id="ADD27026.1"
FT                   /translation="MKRWFAIIALFSLAWAAPALTLYDQLAPILDQVRTLQNSNPARAL
FT                   ELLAQAEDNFRKGAGELPPVLREGIQQSLADARQALARRSSADLEARIQIIKAILGKAL
FT                   YDGYFNALDKGNTEDAGRLLPKVLAASGLPNSLQAQVQTLAAANNLEGVRRLFERTYAQ
FT                   GIANALQRAQAQTSAVRAYLEATRAYALYLIVQDSPRARGLSAKAFVDALGKLSSGNLG
FT                   GFKTDVQGLLTQAQNFLRAASSPQSQRRSNPTTTTQTPPAAGGVRLEAPRTPPAPRETA
FT                   PAIAVQTRPAVQAASTPDAYQQLLGDLRFLIKDSRQLERVADSLTGAGVYSIDDWKRAL
FT                   LEVRGRLLEAQAQVENGQTDLARRTLAQVSARYRTAIAPLIEALRPELAQRTNRVLDLA
FT                   ENAVGLRTSDFTVLSGELLENALVLEGRSLGAFHSLQIWLLQTILGIPRAFLFILAGLL
FT                   AFFPLYLLKLTFGGRNVYWRLLGLAFFFLLLPAMMEGLSYIGSILSDPRYGRLPFLGVL
FT                   TNLSIQQNLVAQLFWGLTVFLVIIFATIGLRGIATQFGLLQNQRTPVQRSRSSTLAQTA
FT                   AGSAAGAAASTKPHPGLTSETIVEWDEEF"
     MKRWFAIIAL FSLAWAAPAL TLYDQLAPIL DQVRTLQNSN PARALELLAQ AEDNFRKGAG        60
     ELPPVLREGI QQSLADARQA LARRSSADLE ARIQIIKAIL GKALYDGYFN ALDKGNTEDA       120
     GRLLPKVLAA SGLPNSLQAQ VQTLAAANNL EGVRRLFERT YAQGIANALQ RAQAQTSAVR       180
     AYLEATRAYA LYLIVQDSPR ARGLSAKAFV DALGKLSSGN LGGFKTDVQG LLTQAQNFLR       240
     AASSPQSQRR SNPTTTTQTP PAAGGVRLEA PRTPPAPRET APAIAVQTRP AVQAASTPDA       300
     YQQLLGDLRF LIKDSRQLER VADSLTGAGV YSIDDWKRAL LEVRGRLLEA QAQVENGQTD       360
     LARRTLAQVS ARYRTAIAPL IEALRPELAQ RTNRVLDLAE NAVGLRTSDF TVLSGELLEN       420
     ALVLEGRSLG AFHSLQIWLL QTILGIPRAF LFILAGLLAF FPLYLLKLTF GGRNVYWRLL       480
     GLAFFFLLLP AMMEGLSYIG SILSDPRYGR LPFLGVLTNL SIQQNLVAQL FWGLTVFLVI       540
     IFATIGLRGI ATQFGLLQNQ RTPVQRSRSS TLAQTAAGSA AGAAASTKPH PGLTSETIVE       600
     WDEEF                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page