(data stored in ACNUC7421 zone)

EMBL: CP001743.PE248

CP001743.PE248       Location/Qualifiers
FT   CDS             complement(221637..222092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: A8J328 S-isoprenylcysteine
FT                   O-methyltransferase; COGs: COG2020 Putative
FT                   protein-S-isoprenylcysteine methyltransferase; KEGG:
FT                   eba:ebD26 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27030"
FT                   /protein_id="ADD27030.1"
FT                   /translation="MRLGERGEGYVVGQFALLGLLVLALWVTPSFSPPWLGGLGRGLAW
FT                   VGLGVLLLAAWQLGRNLTALPKPRPGGYLVQQGLYRVVRHPIYCGVLLWALGSSLAHLN
FT                   LWTLLLCGLLFVWLDRKASLEETWLQERFPGYSAYRQRVKKLIPWVY"
     MRLGERGEGY VVGQFALLGL LVLALWVTPS FSPPWLGGLG RGLAWVGLGV LLLAAWQLGR        60
     NLTALPKPRP GGYLVQQGLY RVVRHPIYCG VLLWALGSSL AHLNLWTLLL CGLLFVWLDR       120
     KASLEETWLQ ERFPGYSAYR QRVKKLIPWV Y                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page