(data stored in ACNUC7421 zone)

EMBL: CP001743.PE251

CP001743.PE251       Location/Qualifiers
FT   CDS             complement(223708..224829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0255"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; SPTR: A7M0U3 Putative
FT                   uncharacterized protein; InterPro
FT                   IPR013526:IPR013525:IPR000412; COGs: COG0842 ABC-type
FT                   multidrug transport system permease component; KEGG:
FT                   smt:Smal_1356 ABC-2 type transporter; PFAM: ABC-2 type
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27033"
FT                   /protein_id="ADD27033.1"
FT                   /translation="MSRILALAQKEFTQIRRDHVLSRLIVGLPIVMTLLFGYAINFTLS
FT                   GIRLAVYDGSQDRISQYLLQELQKENRFTLTHIAQNPAEVPQAIQKNQARVGLVIPSGA
FT                   LQAVRQDKAVQLEVFVDGADPNFAFQAQAALRKVLGDVNSRLLAGKVLAGTATTPPLTP
FT                   SLHTLYNPDNKTAWFTIPGIIGLIMTIFTVLLTALSIVRENEGRTMEALMASPIKPYEV
FT                   VLGKVLPYFVIATLVSLVVLSIGHWVFGVPVRGSLLLLFGLIVLFVLGSLGVGVLISTL
FT                   ARTQIQAVFGTFAYILPTIFLSGFVFPVDGMPLLFRWLAAVIPARYLIDGTRGVMLRGA
FT                   GLETLWVDLVALVIFSVAVLGLASLRFGKRLAA"
     MSRILALAQK EFTQIRRDHV LSRLIVGLPI VMTLLFGYAI NFTLSGIRLA VYDGSQDRIS        60
     QYLLQELQKE NRFTLTHIAQ NPAEVPQAIQ KNQARVGLVI PSGALQAVRQ DKAVQLEVFV       120
     DGADPNFAFQ AQAALRKVLG DVNSRLLAGK VLAGTATTPP LTPSLHTLYN PDNKTAWFTI       180
     PGIIGLIMTI FTVLLTALSI VRENEGRTME ALMASPIKPY EVVLGKVLPY FVIATLVSLV       240
     VLSIGHWVFG VPVRGSLLLL FGLIVLFVLG SLGVGVLIST LARTQIQAVF GTFAYILPTI       300
     FLSGFVFPVD GMPLLFRWLA AVIPARYLID GTRGVMLRGA GLETLWVDLV ALVIFSVAVL       360
     GLASLRFGKR LAA                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page