(data stored in ACNUC7421 zone)

EMBL: CP001743.PE252

CP001743.PE252       Location/Qualifiers
FT   CDS             complement(224826..225701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0256"
FT                   /product="heme exporter protein CcmA"
FT                   /note="TIGRFAM: heme exporter protein CcmA; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; InterPro
FT                   IPR003439:IPR003593:IPR017871:IPR005895; KEGG:
FT                   gur:Gura_1149 ABC transporter related; COGs: COG1131
FT                   ABC-type multidrug transport system ATPase component; SPTR:
FT                   A6CED0 ABC transporter, ATP-binding protein; PFAM: ABC
FT                   transporter; TIGRFAM: heme ABC exporter, ATP-binding
FT                   protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27034"
FT                   /protein_id="ADD27034.1"
FT                   /translation="MISVTQISRRFGPLVALNNVSLEVRPGEVFGLLGPNGAGKTTLIR
FT                   ILSGVLLPSAGQAQVAGLDVTRFPEQVKAAIGYATQEASVYRDLTVRENLEFRARLYLK
FT                   AQAVPQAVETTLQRFGLQDFAHRLAGALSGGWRQRLALAQAVVHGPRVVFLDEPTTGLD
FT                   PVSRRIIWDLIHQEAARGAVVLVTTHYMDEAERCHRLALLFGGQVVAQGTPHELEQLAL
FT                   QQARVAYCETDLPLQRIRALPGVLDAWPSGRGVRLILEQQASLSLPLQTVYPNLEDVFI
FT                   ILTRRQGGAA"
     MISVTQISRR FGPLVALNNV SLEVRPGEVF GLLGPNGAGK TTLIRILSGV LLPSAGQAQV        60
     AGLDVTRFPE QVKAAIGYAT QEASVYRDLT VRENLEFRAR LYLKAQAVPQ AVETTLQRFG       120
     LQDFAHRLAG ALSGGWRQRL ALAQAVVHGP RVVFLDEPTT GLDPVSRRII WDLIHQEAAR       180
     GAVVLVTTHY MDEAERCHRL ALLFGGQVVA QGTPHELEQL ALQQARVAYC ETDLPLQRIR       240
     ALPGVLDAWP SGRGVRLILE QQASLSLPLQ TVYPNLEDVF IILTRRQGGA A                291
//

If you have problems or comments...

PBIL Back to PBIL home page