(data stored in ACNUC7421 zone)

EMBL: CP001743.PE255

CP001743.PE255       Location/Qualifiers
FT   CDS             227049..227480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0259"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: A0ZMK0 Putative uncharacterized protein
FT                   (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27037"
FT                   /protein_id="ADD27037.1"
FT                   /translation="MALQQRIESLLRALGVPDLNVEVPSVADEEGFLEALEAAITSFVE
FT                   DGEDDQSPLGLIEADPSAYDLSDEPDHEELQNAVRDFMNAGDSQLTLITPESPIQPDGG
FT                   ENPSKFWVFLLQMPSLSEHRWWAIVDKNGRHDTYNYGVI"
     MALQQRIESL LRALGVPDLN VEVPSVADEE GFLEALEAAI TSFVEDGEDD QSPLGLIEAD        60
     PSAYDLSDEP DHEELQNAVR DFMNAGDSQL TLITPESPIQ PDGGENPSKF WVFLLQMPSL       120
     SEHRWWAIVD KNGRHDTYNY GVI                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page