(data stored in ACNUC7421 zone)

EMBL: CP001743.PE256

CP001743.PE256       Location/Qualifiers
FT   CDS             complement(227516..228511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0260"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein A;
FT                   PFAM: Radical SAM domain protein; molybdenum cofactor
FT                   synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; InterPro
FT                   IPR010505:IPR007197:IPR006638:IPR013483; KEGG:
FT                   dal:Dalk_2755 molybdenum cofactor biosynthesis protein A;
FT                   COGs: COG2896 Molybdenum cofactor biosynthesis protein;
FT                   SPTR: A5CYZ0 Molybdenum cofactor biosynthesis protein A;
FT                   PFAM: Radical SAM superfamily; Molybdenum Cofactor
FT                   Synthesis C; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27038"
FT                   /protein_id="ADD27038.1"
FT                   /translation="MQHGVASVKLTDQYGRIIKDLRLSVTPRCNLHCLYCHPLGWEQSE
FT                   PPGTISVEDTRHFLRAMQLLGLESVRFTGGEPLVRKELPQMIAAASELGIPDIAITTNG
FT                   LLFKRKARELLSAGLKRINLSMDAVTPEVFRSMTRGGQVEKVWEAIETAWELGMHPVKI
FT                   NAVMIRGMNEQEVIPLAALSLDKPLEVRFLEYMHLDNSNPELYHARFISGAETRARIEA
FT                   HFGPLERVDHDPTAPARVYHIPGAVGTVGFINPVTEPFCSKCSRLRLTADKKIRPCLLT
FT                   DLEMDIAWAFEAENPVEALVDAILLATDRKPAFGNTLPTLRERVMVGIGG"
     MQHGVASVKL TDQYGRIIKD LRLSVTPRCN LHCLYCHPLG WEQSEPPGTI SVEDTRHFLR        60
     AMQLLGLESV RFTGGEPLVR KELPQMIAAA SELGIPDIAI TTNGLLFKRK ARELLSAGLK       120
     RINLSMDAVT PEVFRSMTRG GQVEKVWEAI ETAWELGMHP VKINAVMIRG MNEQEVIPLA       180
     ALSLDKPLEV RFLEYMHLDN SNPELYHARF ISGAETRARI EAHFGPLERV DHDPTAPARV       240
     YHIPGAVGTV GFINPVTEPF CSKCSRLRLT ADKKIRPCLL TDLEMDIAWA FEAENPVEAL       300
     VDAILLATDR KPAFGNTLPT LRERVMVGIG G                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page