(data stored in ACNUC7421 zone)

EMBL: CP001743.PE260

CP001743.PE260       Location/Qualifiers
FT   CDS             complement(230984..232168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0264"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; SPTR: A3HXQ9
FT                   Butyryl-CoA dehydrogenase;
FT                   InterProIPR006090:IPR006092:IPR006091:IPR013107:IPR 006089;
FT                   COGs: COG1960 Acyl-CoA dehydrogenase; KEGG: acp:A2cp1_2299
FT                   acyl-CoA dehydrogenase domain protein; PFAM: Acyl-CoA
FT                   dehydrogenase, N-terminal domain; Acyl-CoA dehydrogenase,
FT                   middle domain; Acyl-CoA dehydrogenase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27042"
FT                   /protein_id="ADD27042.1"
FT                   /translation="MIADRPRDLWFELDSEERQIIGTLRDFLQAEVAPTAAERDETGAF
FT                   PFEIVKKLGEMGVMGAQVPEQYGGAGLSTRVFARIIEEIAAVDGSLALTVASHNSLCTG
FT                   HILIAGNEQQKRQFLPRLASAEVLGAWGLTEPGSGSDAAAMRTKAEDTGSSWVLNGTKQ
FT                   FITQGSVAGVYVVNARTDAAPSEEKKHLGLSALVFEAPIPGLRIGRKERKLGLNASDTA
FT                   QIIFEDITLPKEALLGERGRGFYDVMRVLEGGRIGIAAMAVGLGRAALEFATKYALERE
FT                   QFGRPIAEFQAVSHKLADMATQLEAARLLYLKAAELRDAGKPFGPAAAQAKLFASEVAV
FT                   QACDEAIQILGGYGYIKEYPVERYWRDARLTRIGEGTSEVLKVIIAKHLLAQYR"
     MIADRPRDLW FELDSEERQI IGTLRDFLQA EVAPTAAERD ETGAFPFEIV KKLGEMGVMG        60
     AQVPEQYGGA GLSTRVFARI IEEIAAVDGS LALTVASHNS LCTGHILIAG NEQQKRQFLP       120
     RLASAEVLGA WGLTEPGSGS DAAAMRTKAE DTGSSWVLNG TKQFITQGSV AGVYVVNART       180
     DAAPSEEKKH LGLSALVFEA PIPGLRIGRK ERKLGLNASD TAQIIFEDIT LPKEALLGER       240
     GRGFYDVMRV LEGGRIGIAA MAVGLGRAAL EFATKYALER EQFGRPIAEF QAVSHKLADM       300
     ATQLEAARLL YLKAAELRDA GKPFGPAAAQ AKLFASEVAV QACDEAIQIL GGYGYIKEYP       360
     VERYWRDARL TRIGEGTSEV LKVIIAKHLL AQYR                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page