(data stored in ACNUC7421 zone)

EMBL: CP001743.PE261

CP001743.PE261       Location/Qualifiers
FT   CDS             232371..232748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0265"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; InterPro IPR003029; KEGG:
FT                   bsu:BSU00630 hypothetical protein; COGs: COG1098 RNA
FT                   binding protein (contains ribosomal protein S1 domain);
FT                   SPTR: A6NQP1 Putative uncharacterized protein; PFAM: S1 RNA
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27043"
FT                   /protein_id="ADD27043.1"
FT                   /translation="MELEAGAIVEGRVTRIMEFGAFVEFPNGESGLVHISQVAHEFVKN
FT                   IRDHLNEGDVVSVLVLGRDEKGRLDLSIKELTPAPVEPPRPKRLPRQAPDFENKLKSFL
FT                   RGSGGFGGGKKPGGKGGRKRR"
     MELEAGAIVE GRVTRIMEFG AFVEFPNGES GLVHISQVAH EFVKNIRDHL NEGDVVSVLV        60
     LGRDEKGRLD LSIKELTPAP VEPPRPKRLP RQAPDFENKL KSFLRGSGGF GGGKKPGGKG       120
     GRKRR                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page