(data stored in ACNUC7421 zone)

EMBL: CP001743.PE264

CP001743.PE264       Location/Qualifiers
FT   CDS             234250..234771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_4718 hypothetical protein; SPTR:
FT                   A3IAA1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27046"
FT                   /protein_id="ADD27046.1"
FT                   /translation="MLSRFGDADRCLRHLERSRQELLQLVEGLTDGVLLGRPGPEVWSP
FT                   AEVLEHLALVEESAGKIIRRLRKVALGEAEPFPPPPPGRTRPDGRFLAPPPMEPKGGLT
FT                   RAQLLERLEAVRQRLLLEVAESGERLPRPPTYAHPFFGELTALGWLQTLAYHERHHLQQ
FT                   LRQRLSRLAP"
     MLSRFGDADR CLRHLERSRQ ELLQLVEGLT DGVLLGRPGP EVWSPAEVLE HLALVEESAG        60
     KIIRRLRKVA LGEAEPFPPP PPGRTRPDGR FLAPPPMEPK GGLTRAQLLE RLEAVRQRLL       120
     LEVAESGERL PRPPTYAHPF FGELTALGWL QTLAYHERHH LQQLRQRLSR LAP              173
//

If you have problems or comments...

PBIL Back to PBIL home page