(data stored in ACNUC7421 zone)

EMBL: CP001743.PE27

CP001743.PE27        Location/Qualifiers
FT   CDS             23912..24151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0028"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: P03942 Ferredoxin; KEGG: ank:AnaeK_2333
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   InterPro IPR000813:IPR001450:IPR017900; PFAM: 4Fe-4S
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26809"
FT                   /protein_id="ADD26809.1"
FT                   /translation="MPHVIVEPCIGTKDKSCVEVCPVECIYDGGDQFYIHPDECIDCGA
FT                   CVPACPVSAIYPEEDVPEQWQDYIAKNRKLAGLE"
     MPHVIVEPCI GTKDKSCVEV CPVECIYDGG DQFYIHPDEC IDCGACVPAC PVSAIYPEED        60
     VPEQWQDYIA KNRKLAGLE                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page