(data stored in ACNUC7421 zone)

EMBL: CP001743.PE270

CP001743.PE270       Location/Qualifiers
FT   CDS             complement(239945..240280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0274"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; SPTR:
FT                   A7JXZ4 Possible pectin degradation protein; KEGG:
FT                   kpn:KPN_03255 hypothetical protein; COGs: COG1917 conserved
FT                   hypothetical protein contains double-stranded beta-helix
FT                   domain; InterPro IPR013096; PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27052"
FT                   /protein_id="ADD27052.1"
FT                   /translation="MQLNGDWEAVEPGIERRLVALGQRMMAVRVRFAKGAAGTAHTHPH
FT                   EQLTQVLSGRFRFWLGQEAREVVAGESLLIPGGLEHGAEALEAGELLDVFSPLREDLLD
FT                   GPTAHPE"
     MQLNGDWEAV EPGIERRLVA LGQRMMAVRV RFAKGAAGTA HTHPHEQLTQ VLSGRFRFWL        60
     GQEAREVVAG ESLLIPGGLE HGAEALEAGE LLDVFSPLRE DLLDGPTAHP E                111
//

If you have problems or comments...

PBIL Back to PBIL home page