(data stored in ACNUC7421 zone)

EMBL: CP001743.PE271

CP001743.PE271       Location/Qualifiers
FT   CDS             complement(240290..241228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0275"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; SPTR: A8KP27 Kinase, PfkB
FT                   family; InterPro IPR011611:IPR002173; COGs: COG0524 Sugar
FT                   kinase ribokinase family; KEGG: sit:TM1040_2753 PfkB; PFAM:
FT                   pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27053"
FT                   /protein_id="ADD27053.1"
FT                   /translation="MKTLDLVGLGECMVEFFTDEPLGQARTFTRSFGGDVLNALVAAAR
FT                   LGSATGFITLVGNDPFGPGLLQAWQAEGVDTALAPLVEGENGVYFISLLENGEREFTYR
FT                   RQGSAASRLSPEHIQPAYLAGARMLLLSGITQAISPSAQAATLRAAEQARSAGLWVAFD
FT                   PNYRPRLWALRGGLETARQALGEILPYVDLLLPSQPADLALWGLEHLEAPTALRVLLQY
FT                   VPRVGLKAGAEGAWLGWEGQIQHVPPASPHQVRDTTGAGDAWNGAFLHGLLQGWNPLEA
FT                   ALQANRLAAAKLAYRGAIPPRPWPLELSDLA"
     MKTLDLVGLG ECMVEFFTDE PLGQARTFTR SFGGDVLNAL VAAARLGSAT GFITLVGNDP        60
     FGPGLLQAWQ AEGVDTALAP LVEGENGVYF ISLLENGERE FTYRRQGSAA SRLSPEHIQP       120
     AYLAGARMLL LSGITQAISP SAQAATLRAA EQARSAGLWV AFDPNYRPRL WALRGGLETA       180
     RQALGEILPY VDLLLPSQPA DLALWGLEHL EAPTALRVLL QYVPRVGLKA GAEGAWLGWE       240
     GQIQHVPPAS PHQVRDTTGA GDAWNGAFLH GLLQGWNPLE AALQANRLAA AKLAYRGAIP       300
     PRPWPLELSD LA                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page