(data stored in ACNUC7421 zone)

EMBL: CP001743.PE273

CP001743.PE273       Location/Qualifiers
FT   CDS             complement(241877..242632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0277"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /note="TIGRFAM: 2-deoxy-D-gluconate 3-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   NAD-dependent epimerase/dehydratase;
FT                   InterProIPR002347:IPR002424:IPR002198:IPR013968:IPR
FT                   001509:IPR011286; KEGG: mmr:Mmar10_0232 2-deoxy-D-gluconate
FT                   3-dehydrogenase; COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); SPTR: P50842 2-deoxy-D-gluconate
FT                   3-dehydrogenase; PFAM: short chain dehydrogenase; TIGRFAM:
FT                   2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27055"
FT                   /protein_id="ADD27055.1"
FT                   /translation="MQMFSLEGRVALVTGGAVGIGQAIAIGLAQAGADVAIVTHTADAA
FT                   QTRQAVQAAGRRFHLVQANLMQPESAARAIAETEAALGPLDILVNNAGIIRREWAEHFS
FT                   DTDWQEVIELNLNAVWRLSQTAGQGMLKRGRGKIINIASLLSFQGGIRVPSYTAAKHAV
FT                   AGLTKALANEWAARGLNVNAIAPGYIATDNTAALRADPERSRQILERIPAGRWGQPSDL
FT                   VGAAIFLASSASDYVHGHVLVVDGGWMAR"
     MQMFSLEGRV ALVTGGAVGI GQAIAIGLAQ AGADVAIVTH TADAAQTRQA VQAAGRRFHL        60
     VQANLMQPES AARAIAETEA ALGPLDILVN NAGIIRREWA EHFSDTDWQE VIELNLNAVW       120
     RLSQTAGQGM LKRGRGKIIN IASLLSFQGG IRVPSYTAAK HAVAGLTKAL ANEWAARGLN       180
     VNAIAPGYIA TDNTAALRAD PERSRQILER IPAGRWGQPS DLVGAAIFLA SSASDYVHGH       240
     VLVVDGGWMA R                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page