(data stored in ACNUC7421 zone)

EMBL: CP001743.PE278

CP001743.PE278       Location/Qualifiers
FT   CDS             complement(246860..247888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0282"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; InterPro IPR000843:IPR001761;
FT                   KEGG: vei:Veis_0948 periplasmic binding protein/LacI
FT                   transcriptional regulator; COGs: COG1609 Transcriptional
FT                   regulators; SPTR: A7CQD4 Periplasmic binding protein/LacI
FT                   transcriptional regulator; PFAM: Bacterial regulatory
FT                   proteins, lacI family; Periplasmic binding proteins and
FT                   sugar binding domain of the LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27060"
FT                   /protein_id="ADD27060.1"
FT                   /translation="MSSEKVTLAHVARLAGVSIITVSRVLNNKGRFSEATRARVLQAAN
FT                   QLGYVANTAARSLRGHPTQILGMVIPELVSPYFAELARAAADAASQMGYDLAVFTTSRD
FT                   PERERERVGALLGGLADGLIIVVPIGSAGFLASLERSRAPVVLVNHFGAPTHLPVVRAD
FT                   SFEGSLAAVRHLLALGHRRIGFITGAAHSSQATERLRAYRECMLAAGLWDERLVRPGDF
FT                   TQQRGVEAGHELLSLEEPPTAIFAASDLTAFGVIAAAQARGLQVPQDLSVVGFDDIPTA
FT                   AHSHPSLTTVAHPIQAMGQAMVDLIIKAKAGEQVRDVLVEFPSELIVRESSAPPRIPGE
FT                   KV"
     MSSEKVTLAH VARLAGVSII TVSRVLNNKG RFSEATRARV LQAANQLGYV ANTAARSLRG        60
     HPTQILGMVI PELVSPYFAE LARAAADAAS QMGYDLAVFT TSRDPERERE RVGALLGGLA       120
     DGLIIVVPIG SAGFLASLER SRAPVVLVNH FGAPTHLPVV RADSFEGSLA AVRHLLALGH       180
     RRIGFITGAA HSSQATERLR AYRECMLAAG LWDERLVRPG DFTQQRGVEA GHELLSLEEP       240
     PTAIFAASDL TAFGVIAAAQ ARGLQVPQDL SVVGFDDIPT AAHSHPSLTT VAHPIQAMGQ       300
     AMVDLIIKAK AGEQVRDVLV EFPSELIVRE SSAPPRIPGE KV                          342
//

If you have problems or comments...

PBIL Back to PBIL home page