(data stored in ACNUC7421 zone)

EMBL: CP001743.PE279

CP001743.PE279       Location/Qualifiers
FT   CDS             248066..249094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0283"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; InterPro IPR000843:IPR001761;
FT                   KEGG: hch:HCH_06913 transcriptional regulator; COGs:
FT                   COG1609 Transcriptional regulators; SPTR: A3UQH9
FT                   Transcriptional regulator; PFAM: Periplasmic binding
FT                   proteins and sugar binding domain of the LacI family;
FT                   Bacterial regulatory proteins, lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27061"
FT                   /protein_id="ADD27061.1"
FT                   /translation="MREAVTLSDVAREAGVSPSTVSRVINGTARVAASKREAVLRAIER
FT                   LHYRPNIMAKGLAQGRSLTIGVITQEISSPYYAEMLKGVEQALEGTAYHPIFASGHWRV
FT                   DQEEAALKVLVGRQVDGLIVMDGSVPEERLKELAHTMPVVVVGRRIPGLQCLGIDNRRA
FT                   AYEGVQHLIELGHRRIAHIAGPTSHPDSIERLEGYRAALEDAHIPFDPALVVVGDYMEQ
FT                   SGVLAVEALLARGALFTAIFAANDQMAYGANVALYRRGIRVPHDVSLVGFDDLPSSSYF
FT                   TPPLTTVRQPGPAMGWEAARLMLALLEGRDYTPKPLSTHLVVRESTALIRSTGALAAHL
FT                   LT"
     MREAVTLSDV AREAGVSPST VSRVINGTAR VAASKREAVL RAIERLHYRP NIMAKGLAQG        60
     RSLTIGVITQ EISSPYYAEM LKGVEQALEG TAYHPIFASG HWRVDQEEAA LKVLVGRQVD       120
     GLIVMDGSVP EERLKELAHT MPVVVVGRRI PGLQCLGIDN RRAAYEGVQH LIELGHRRIA       180
     HIAGPTSHPD SIERLEGYRA ALEDAHIPFD PALVVVGDYM EQSGVLAVEA LLARGALFTA       240
     IFAANDQMAY GANVALYRRG IRVPHDVSLV GFDDLPSSSY FTPPLTTVRQ PGPAMGWEAA       300
     RLMLALLEGR DYTPKPLSTH LVVRESTALI RSTGALAAHL LT                          342
//

If you have problems or comments...

PBIL Back to PBIL home page