(data stored in ACNUC7421 zone)

EMBL: CP001743.PE280

CP001743.PE280       Location/Qualifiers
FT   CDS             249189..250421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0284"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: A6AMP9 ABC-type sugar transport system, periplasmic
FT                   component; InterPro IPR006059; COGs: COG1653 ABC-type sugar
FT                   transport system periplasmic component; KEGG: rfr:Rfer_1099
FT                   extracellular solute-binding protein; PFAM: Bacterial
FT                   extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27062"
FT                   /protein_id="ADD27062.1"
FT                   /translation="MKQIPSLLALLVLFGLGLAQKTTLTVGVFPNLDDALKAQIQLFNK
FT                   KYPDVEVKLVIQQYADHHNALTTALATGQGLPDVAAIEIGFVGRFAEGQGFEDLNKAPY
FT                   NAGQYKRFFTPYTIAQATASDGRFIAMPVDIGPGTFFYRVDILQKAGVDPKNMMTWPGY
FT                   IAAGRKIKATTGAFLIADASDVAWINIFATTPANTSPYFDAQGKVIVDSPRFVRAFELA
FT                   KNIRAAGLDARVGAWTNEWYDAFKKGTVATQFSGAWLQGHLQNWMAPETKGLWRVQQLP
FT                   EGMYASWGGSFYAIPTTSKNKALAWELIKFVTTTKEAQVAAFRAIGAFPSLLSAQEDPS
FT                   FNEPIEFLGGQQARLLWRDAARRVKPLKANKYDRIANEILTQALSQVLDEGKDIQAALT
FT                   EAKRLIERRMR"
     MKQIPSLLAL LVLFGLGLAQ KTTLTVGVFP NLDDALKAQI QLFNKKYPDV EVKLVIQQYA        60
     DHHNALTTAL ATGQGLPDVA AIEIGFVGRF AEGQGFEDLN KAPYNAGQYK RFFTPYTIAQ       120
     ATASDGRFIA MPVDIGPGTF FYRVDILQKA GVDPKNMMTW PGYIAAGRKI KATTGAFLIA       180
     DASDVAWINI FATTPANTSP YFDAQGKVIV DSPRFVRAFE LAKNIRAAGL DARVGAWTNE       240
     WYDAFKKGTV ATQFSGAWLQ GHLQNWMAPE TKGLWRVQQL PEGMYASWGG SFYAIPTTSK       300
     NKALAWELIK FVTTTKEAQV AAFRAIGAFP SLLSAQEDPS FNEPIEFLGG QQARLLWRDA       360
     ARRVKPLKAN KYDRIANEIL TQALSQVLDE GKDIQAALTE AKRLIERRMR                  410
//

If you have problems or comments...

PBIL Back to PBIL home page