(data stored in ACNUC7421 zone)

EMBL: CP001743.PE281

CP001743.PE281       Location/Qualifiers
FT   CDS             250473..251456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A6CVW5 ABC-type sugar
FT                   transport system, permease component; InterPro IPR000515;
FT                   COGs: COG1175 ABC-type sugar transport systems permease
FT                   components; KEGG: hch:HCH_06909 ABC-type sugar transport
FT                   system, permease components; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27063"
FT                   /protein_id="ADD27063.1"
FT                   /translation="MRKSVRIPTSGHAGPSLAMRWSSFQRRYAPYIFVSPFFILFLIFG
FT                   LYPTLFSLYMSFQAWTPSDGWGRWKYVGLENYTFTLTDPMFWRSMWNTVWLGVFSGIPQ
FT                   HLIAIPLAFVIHMVLSRFKTFVTAVYFLPYITSSVAIALIFNTLFATNNGVINLVIAHL
FT                   NTWPLLGALLPDQNINWFTSANIKYALALVVIWQFTGWNTLLYLSAIQAIPKDLYEAAA
FT                   VDGATRVQQFRYITLPLLRPMMFFAVSLTIIGNMQLFEQPFVLLNGGASAATPGGQTAT
FT                   MYMYRTAFEWLEMGTAASIAWILFVFIGILTYLNNLIFGRAARGGD"
     MRKSVRIPTS GHAGPSLAMR WSSFQRRYAP YIFVSPFFIL FLIFGLYPTL FSLYMSFQAW        60
     TPSDGWGRWK YVGLENYTFT LTDPMFWRSM WNTVWLGVFS GIPQHLIAIP LAFVIHMVLS       120
     RFKTFVTAVY FLPYITSSVA IALIFNTLFA TNNGVINLVI AHLNTWPLLG ALLPDQNINW       180
     FTSANIKYAL ALVVIWQFTG WNTLLYLSAI QAIPKDLYEA AAVDGATRVQ QFRYITLPLL       240
     RPMMFFAVSL TIIGNMQLFE QPFVLLNGGA SAATPGGQTA TMYMYRTAFE WLEMGTAASI       300
     AWILFVFIGI LTYLNNLIFG RAARGGD                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page