(data stored in ACNUC7421 zone)

EMBL: CP001743.PE282

CP001743.PE282       Location/Qualifiers
FT   CDS             251458..252297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0286"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A6CVW4 ABC-type sugar
FT                   transport system, permease component; InterPro IPR000515;
FT                   COGs: COG0395 ABC-type sugar transport system permease
FT                   component; KEGG: rfr:Rfer_1101 binding-protein-dependent
FT                   transport systems inner membrane component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27064"
FT                   /protein_id="ADD27064.1"
FT                   /translation="MARVSPGGWLLRLGGYALLVLGGVLTIAPFYFMFVFATHQRSEIF
FT                   GFPPPIWFGEHFLTNYQILIEKIPFWRAYWNNFYLALMTTITSLFFCSLAGFGFAMYQF
FT                   RWREQLFAVVMATLLIPAILNLIPFYLLIYQIGWINTPKALWVPAMAGALGIFLMRQYI
FT                   ISAIPKELVDAARIDGCSEFQIYWRIVLPLIRPALGTLGLITFIGSWNRFADVNVIMRT
FT                   QETKTLPVVLRTLQGATDVEWGAIMAGTALLVAPLLLVFALAARQLMEGLTSGAVKS"
     MARVSPGGWL LRLGGYALLV LGGVLTIAPF YFMFVFATHQ RSEIFGFPPP IWFGEHFLTN        60
     YQILIEKIPF WRAYWNNFYL ALMTTITSLF FCSLAGFGFA MYQFRWREQL FAVVMATLLI       120
     PAILNLIPFY LLIYQIGWIN TPKALWVPAM AGALGIFLMR QYIISAIPKE LVDAARIDGC       180
     SEFQIYWRIV LPLIRPALGT LGLITFIGSW NRFADVNVIM RTQETKTLPV VLRTLQGATD       240
     VEWGAIMAGT ALLVAPLLLV FALAARQLME GLTSGAVKS                              279
//

If you have problems or comments...

PBIL Back to PBIL home page