(data stored in ACNUC7421 zone)

EMBL: CP001743.PE283

CP001743.PE283       Location/Qualifiers
FT   CDS             252387..253388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0287"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="PRIAM: Endo-1,4-beta-xylanase; PFAM: glycoside
FT                   hydrolase family 10; SMART: glycoside hydrolase family 10;
FT                   InterPro IPR001000; KEGG: hypothetical protein; COGs:
FT                   COG3693 Beta-1 4-xylanase; SPTR: Q60041
FT                   Endo-1,4-beta-xylanase B; PFAM: Glycosyl hydrolase family
FT                   10"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27065"
FT                   /protein_id="ADD27065.1"
FT                   /translation="MYLTRWTFVGVCLGLMVWAQPGPPLRSLAEARKIQIGAAVEPSLL
FT                   LQEPQYAQVLAREFNLVVAENVMKWGALQTARGEYNFAAADLLLNFAQRNRQAVRGHTL
FT                   VWHQQLPRWMYGSFTSAEMEAILSDHIRTVVGRYRGQIAYWDVVNEAIGDDARLRSTPF
FT                   DVLPGYLEKAFRLARAADPSAKLFYNDYGAEGLGAKSDAIYALLKELRARGVPVDGVGF
FT                   QVHVDSSFSPRQVRMAENLERFAQLGLEIHITEMDVLLSSTGSRAERLERQAQVYREVL
FT                   QVCLRQPRCKVFTLWGFTDAHSWRGASEPLIFDVDYQPKPAYFALQRTLQQP"
     MYLTRWTFVG VCLGLMVWAQ PGPPLRSLAE ARKIQIGAAV EPSLLLQEPQ YAQVLAREFN        60
     LVVAENVMKW GALQTARGEY NFAAADLLLN FAQRNRQAVR GHTLVWHQQL PRWMYGSFTS       120
     AEMEAILSDH IRTVVGRYRG QIAYWDVVNE AIGDDARLRS TPFDVLPGYL EKAFRLARAA       180
     DPSAKLFYND YGAEGLGAKS DAIYALLKEL RARGVPVDGV GFQVHVDSSF SPRQVRMAEN       240
     LERFAQLGLE IHITEMDVLL SSTGSRAERL ERQAQVYREV LQVCLRQPRC KVFTLWGFTD       300
     AHSWRGASEP LIFDVDYQPK PAYFALQRTL QQP                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page