(data stored in ACNUC7421 zone)

EMBL: CP001743.PE288

CP001743.PE288       Location/Qualifiers
FT   CDS             260776..261384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce2901 hypothetical protein; SPTR: Q5UZL3
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27070"
FT                   /protein_id="ADD27070.1"
FT                   /translation="MATQSKKKRKAAAKYRSQPKPSPMPWVLGGVVVLAVLVGGYFWWQ
FT                   SRQTAQAFERLVAAGKASLAAREITYPDAGRGHSNIGVSIVYATDPPTSGVHWPNWTEP
FT                   GFYTRPEPKEKLVHALEHGNIVIYYDQPSAEALSQIRAWQRRFTGAWDGLVVVPKQGLG
FT                   QTIELTAWTKLLRLETWDAALAAAFIDAYRGRGPENPVR"
     MATQSKKKRK AAAKYRSQPK PSPMPWVLGG VVVLAVLVGG YFWWQSRQTA QAFERLVAAG        60
     KASLAAREIT YPDAGRGHSN IGVSIVYATD PPTSGVHWPN WTEPGFYTRP EPKEKLVHAL       120
     EHGNIVIYYD QPSAEALSQI RAWQRRFTGA WDGLVVVPKQ GLGQTIELTA WTKLLRLETW       180
     DAALAAAFID AYRGRGPENP VR                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page