(data stored in ACNUC7421 zone)

EMBL: CP001743.PE289

CP001743.PE289       Location/Qualifiers
FT   CDS             261403..262368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0293"
FT                   /product="Dipeptidylaminopeptidase/acylaminoacyl-peptidase"
FT                   /note="SPTR: A5P745 Prolyl oligopeptidase family protein;
FT                   InterPro IPR002471; COGs: COG1506 Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase; KEGG: mxa:MXAN_5299
FT                   peptidase, S9C (acylaminoacyl-peptidase) subfamily; PFAM:
FT                   Dienelactone hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27071"
FT                   /protein_id="ADD27071.1"
FT                   /translation="MSHTLRFGTTLLAVLLGTALAQGGLEAHPMSIEALRQGSYPGSAI
FT                   TLEQTLAPGANYRRYIASYRSEGLKIYGLLTVPNGARPRAGWPAIVFVHGYIPPAQYRT
FT                   TERYGAYVDALARAGYIVFKIDLRGHGNSEGTASGAYWSPDYTIDTLNAFASLRRFPQA
FT                   NPERIGIWGHSMGGYLALRAMVVEPRIRVGVIWAGVVGTYEDLLYRWRRSPPAQLPPGA
FT                   LRRRELFLARYGSPESNPGFWASITAHNYLERVGPIQLHHGLADTVVPVSFSQRLAQYL
FT                   RAAGRPYELFTYPGNDHNLSQSFSLAMRRSVAYFDRYLKR"
     MSHTLRFGTT LLAVLLGTAL AQGGLEAHPM SIEALRQGSY PGSAITLEQT LAPGANYRRY        60
     IASYRSEGLK IYGLLTVPNG ARPRAGWPAI VFVHGYIPPA QYRTTERYGA YVDALARAGY       120
     IVFKIDLRGH GNSEGTASGA YWSPDYTIDT LNAFASLRRF PQANPERIGI WGHSMGGYLA       180
     LRAMVVEPRI RVGVIWAGVV GTYEDLLYRW RRSPPAQLPP GALRRRELFL ARYGSPESNP       240
     GFWASITAHN YLERVGPIQL HHGLADTVVP VSFSQRLAQY LRAAGRPYEL FTYPGNDHNL       300
     SQSFSLAMRR SVAYFDRYLK R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page