(data stored in ACNUC7421 zone)

EMBL: CP001743.PE29

CP001743.PE29        Location/Qualifiers
FT   CDS             25774..26199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26811"
FT                   /protein_id="ADD26811.1"
FT                   /translation="MKKSILIASLTALALSFATAQDVRIDQGDPSAVLVQWVSLLPQEV
FT                   QLDALSQGQARLLYDALSGLSYAFTPAQAQEVVQAIRQALPQDEVQALERAAAQTASLS
FT                   DSDKEALVYFSGAQFEDSLRTALAQLSVAVTPDYSGE"
     MKKSILIASL TALALSFATA QDVRIDQGDP SAVLVQWVSL LPQEVQLDAL SQGQARLLYD        60
     ALSGLSYAFT PAQAQEVVQA IRQALPQDEV QALERAAAQT ASLSDSDKEA LVYFSGAQFE       120
     DSLRTALAQL SVAVTPDYSG E                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page