(data stored in ACNUC7421 zone)

EMBL: CP001743.PE291

CP001743.PE291       Location/Qualifiers
FT   CDS             262900..263184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0295"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; SPTR:
FT                   A4KFR7 Putative uncharacterized protein; InterPro
FT                   IPR003735; COGs: COG1937 conserved hypothetical protein;
FT                   KEGG: aeh:Mlg_0324 hypothetical protein; PFAM:
FT                   Uncharacterised BCR, COG1937"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27073"
FT                   /protein_id="ADD27073.1"
FT                   /translation="MTHEHTLHLDPRVRQEARNRLLSAKGHLEGILKMLEGEPYCVDVL
FT                   KQIKAVQGALDKVGEMVLRSHLEHHVASAAVRGDTQRMVEELMEVLKYR"
     MTHEHTLHLD PRVRQEARNR LLSAKGHLEG ILKMLEGEPY CVDVLKQIKA VQGALDKVGE        60
     MVLRSHLEHH VASAAVRGDT QRMVEELMEV LKYR                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page