(data stored in ACNUC7421 zone)

EMBL: CP001743.PE293

CP001743.PE293       Location/Qualifiers
FT   CDS             265780..266013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afe:Lferr_0211 hypothetical protein; SPTR:
FT                   A2UAL1 Putative uncharacterized protein; PFAM: Predicted
FT                   membrane protein (DUF2078)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27075"
FT                   /protein_id="ADD27075.1"
FT                   /translation="MMHWWPYGYGMMGGWGWLGMLIQLAILVLLIYLLVRAFSRPASSE
FT                   GRDRALEILRERYARGEIDKETFERMKHDLNG"
     MMHWWPYGYG MMGGWGWLGM LIQLAILVLL IYLLVRAFSR PASSEGRDRA LEILRERYAR        60
     GEIDKETFER MKHDLNG                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page