(data stored in ACNUC7421 zone)

EMBL: CP001743.PE297

CP001743.PE297       Location/Qualifiers
FT   CDS             267211..269631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0301"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase;
FT                   InterProIPR000579:IPR001757:IPR001756:IPR008250:IPR
FT                   005834:IPR001412:IPR006121:IPR006403:IPR006416; KEGG:
FT                   xau:Xaut_4847 copper-translocating P-type ATPase; COGs:
FT                   COG2217 Cation transport ATPase; SPTR: A3TK31 Putative
FT                   cation-transporting ATPase; PFAM: E1-E2 ATPase; haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: heavy metal
FT                   translocating P-type ATPase; heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase; ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC;
FT                   copper-(or silver)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27079"
FT                   /protein_id="ADD27079.1"
FT                   /translation="MSKADHDPHLPEALLELSLKNCHDASEQADLERHLARLPGVSSVH
FT                   LDRTRALAHISFDPGQISAQDLRERLERGGYSCACQECEASVCQPGHPRVGSDDQPHTH
FT                   PHHHPAHEVVTEPHAHRTAPTKAHDHAAMPPVHDAHAGHGAAMVADMLRRFVVSLLLTL
FT                   PIVIFSPIGGSLGFPEMPPFGISMGLWGFLLSTPVVWWGGWPFIRAAWRALRRGEANMM
FT                   TLIATGILVSWTFSVAATFLFEGEVFYEAAAMLTTFSLAGHWMEMRSRFATGRAVEALL
FT                   KLAPATARVLRGGQEVEIPLEQVVVGDVIVVKPGDRVPVDGVVLSGQSYVDESMISGEP
FT                   IPVAKAPGSKVIGGSVNQTGAFTFEATAVGADTALSRIVQMVQNAQASKAPAQRLADIA
FT                   GKYLVFIALGSGLLTFVFWYFFAAQGLVFALTAGVSAIVIACPDALALATPTAITVGVG
FT                   VAAREGVLFKNATALEATAGVDTVIFDKTGTLTEGKPALTDLITAGGMAEQELLRLAAS
FT                   ADLPSQHPLAEAIVRAAREQGLTLNQPEEFDSVPGHGVVAKVHGQRVLIGNKKLMEREK
FT                   VAVEALEERAAQLSADGKTAMFVAVDGRAAGVVAVADAVRESAKRAVGLLHALGIETVM
FT                   LTGDNRRTAEAVARQIGIDTVIAEVLPEDKAAKVKELQAQGRKVAMVGDGVNDAPALAQ
FT                   ADVGIAIGAGTDVAVESAEVVLVKNDPADVAKAIQLARKVRGKIKQNLFWAAIYNVLAI
FT                   PIAAGVLYNSYGLLLRPEWAALLMSASTVIVTLNALLLGVRSRPRELTKGVGA"
     MSKADHDPHL PEALLELSLK NCHDASEQAD LERHLARLPG VSSVHLDRTR ALAHISFDPG        60
     QISAQDLRER LERGGYSCAC QECEASVCQP GHPRVGSDDQ PHTHPHHHPA HEVVTEPHAH       120
     RTAPTKAHDH AAMPPVHDAH AGHGAAMVAD MLRRFVVSLL LTLPIVIFSP IGGSLGFPEM       180
     PPFGISMGLW GFLLSTPVVW WGGWPFIRAA WRALRRGEAN MMTLIATGIL VSWTFSVAAT       240
     FLFEGEVFYE AAAMLTTFSL AGHWMEMRSR FATGRAVEAL LKLAPATARV LRGGQEVEIP       300
     LEQVVVGDVI VVKPGDRVPV DGVVLSGQSY VDESMISGEP IPVAKAPGSK VIGGSVNQTG       360
     AFTFEATAVG ADTALSRIVQ MVQNAQASKA PAQRLADIAG KYLVFIALGS GLLTFVFWYF       420
     FAAQGLVFAL TAGVSAIVIA CPDALALATP TAITVGVGVA AREGVLFKNA TALEATAGVD       480
     TVIFDKTGTL TEGKPALTDL ITAGGMAEQE LLRLAASADL PSQHPLAEAI VRAAREQGLT       540
     LNQPEEFDSV PGHGVVAKVH GQRVLIGNKK LMEREKVAVE ALEERAAQLS ADGKTAMFVA       600
     VDGRAAGVVA VADAVRESAK RAVGLLHALG IETVMLTGDN RRTAEAVARQ IGIDTVIAEV       660
     LPEDKAAKVK ELQAQGRKVA MVGDGVNDAP ALAQADVGIA IGAGTDVAVE SAEVVLVKND       720
     PADVAKAIQL ARKVRGKIKQ NLFWAAIYNV LAIPIAAGVL YNSYGLLLRP EWAALLMSAS       780
     TVIVTLNALL LGVRSRPREL TKGVGA                                            806
//

If you have problems or comments...

PBIL Back to PBIL home page