(data stored in ACNUC7421 zone)

EMBL: CP001743.PE299

CP001743.PE299       Location/Qualifiers
FT   CDS             270342..271424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0303"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PRIAM: Histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein;
FT                   InterProIPR004358:IPR003594:IPR003660:IPR003661:IPR 005467;
FT                   KEGG: gme:Gmet_2694 PAS/PAC sensor signal transduction
FT                   histidine kinase; COGs: COG5002 Signal transduction
FT                   histidine kinase; SPTR: A0YKL7 Sensor protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   HAMP domain; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27081"
FT                   /protein_id="ADD27081.1"
FT                   /translation="MMFVRLFITHWLVALVALVALLAFAEWLAPRFYRSHLEQMMTLMG
FT                   SQSLELRSDLERGLRSTLTTAWLASLPLAGLLAGLMAWLASRRISQSVRQLAQGSRAIA
FT                   LGQYQNRLKVQGDDELASLAQDFNRMTEALEKVEQHRTELLSSVAHELRTPLSALQGYS
FT                   EALADGVLPPEQAAAHIEREVRAMGRLIDDLALVSRIEAQAVELHPQVVAVEAAFQEAL
FT                   ERYATAFEACGVALKLNPLPSSVALWADPLRLQQVLSNLLSNALRYTPAGGEVVLSASL
FT                   QSHHVRICVCDTGVGIPLEHQPRIFERFYRADPARSRHTGGSGVGLTIAKGLVEAMGGQ
FT                   MGFESEVGKGSCFWFTLPRA"
     MMFVRLFITH WLVALVALVA LLAFAEWLAP RFYRSHLEQM MTLMGSQSLE LRSDLERGLR        60
     STLTTAWLAS LPLAGLLAGL MAWLASRRIS QSVRQLAQGS RAIALGQYQN RLKVQGDDEL       120
     ASLAQDFNRM TEALEKVEQH RTELLSSVAH ELRTPLSALQ GYSEALADGV LPPEQAAAHI       180
     EREVRAMGRL IDDLALVSRI EAQAVELHPQ VVAVEAAFQE ALERYATAFE ACGVALKLNP       240
     LPSSVALWAD PLRLQQVLSN LLSNALRYTP AGGEVVLSAS LQSHHVRICV CDTGVGIPLE       300
     HQPRIFERFY RADPARSRHT GGSGVGLTIA KGLVEAMGGQ MGFESEVGKG SCFWFTLPRA       360
//

If you have problems or comments...

PBIL Back to PBIL home page