(data stored in ACNUC7421 zone)

EMBL: CP001743.PE3

CP001743.PE3         Location/Qualifiers
FT   CDS             3114..4388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0003"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="TIGRFAM: enolase; PRIAM: Phosphopyruvate hydratase;
FT                   PFAM: enolase; SPTR: Q5SME1 Enolase; KEGG: aba:Acid345_1070
FT                   enolase; COGs: COG0148 Enolase; InterPro IPR000941; PFAM:
FT                   Enolase, N-terminal domain; Enolase, C-terminal TIM barrel
FT                   domain; TIGRFAM: phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26785"
FT                   /protein_id="ADD26785.1"
FT                   /translation="MTTIVEIKGREVLDSRGNPTVEAEVVLESGARGRAMVPSGASTGA
FT                   HEAVELRDGGPRFGGKGVLRAVAAINERIADEVIGLDALNQEAVDKTMLELDGTPNKGN
FT                   LGANAILAVSLATAHAAASGLGLPLYRYLGGVQGVTLPVPLMNVINGGKHADNNVDFQE
FT                   FMLVPGGLPTFSEALRAGVETFHALKSVLKAKGYNTNVGDEGGFAPDLKSNEEAVEVLL
FT                   TAIEKAGYKPGQEIAIALDPASSEFYQEGRYVLEADGKSLSGPEMVAYWENWVNQYPIV
FT                   SIEDGLAEDDWETWKLLTERLGRRIQLVGDDLFVTNPAILKRGIELGVGNSILVKVNQI
FT                   GTLSETLEAIRLAHRSGYTTILSHRSGETEDNTIADIAVAVNAGQIKTGSASRSDRLAK
FT                   YNQLLRIEEELGTGARFLGFGAFKK"
     MTTIVEIKGR EVLDSRGNPT VEAEVVLESG ARGRAMVPSG ASTGAHEAVE LRDGGPRFGG        60
     KGVLRAVAAI NERIADEVIG LDALNQEAVD KTMLELDGTP NKGNLGANAI LAVSLATAHA       120
     AASGLGLPLY RYLGGVQGVT LPVPLMNVIN GGKHADNNVD FQEFMLVPGG LPTFSEALRA       180
     GVETFHALKS VLKAKGYNTN VGDEGGFAPD LKSNEEAVEV LLTAIEKAGY KPGQEIAIAL       240
     DPASSEFYQE GRYVLEADGK SLSGPEMVAY WENWVNQYPI VSIEDGLAED DWETWKLLTE       300
     RLGRRIQLVG DDLFVTNPAI LKRGIELGVG NSILVKVNQI GTLSETLEAI RLAHRSGYTT       360
     ILSHRSGETE DNTIADIAVA VNAGQIKTGS ASRSDRLAKY NQLLRIEEEL GTGARFLGFG       420
     AFKK                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page