(data stored in ACNUC7421 zone)

EMBL: CP001743.PE30

CP001743.PE30        Location/Qualifiers
FT   CDS             26438..27142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0031"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; InterPro IPR001789:IPR001867; KEGG: dac:Daci_0123
FT                   two component transcriptional regulator; COGs: COG0745
FT                   Response regulators consisting of a CheY-like receiver
FT                   domain and a winged-helix DNA-binding domain; SPTR: A3RYN8
FT                   Transcriptional regulator, two component response
FT                   regulator; PFAM: Transcriptional regulatory protein, C
FT                   terminal; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26812"
FT                   /protein_id="ADD26812.1"
FT                   /translation="MSSTADTLDSMALVLVVEDEPEIAEILEGYLRREGFRTERASDGR
FT                   QALNLVRAARPDLVLLDIMLPEMDGLEVLRRIRSSGHTPVILVTARTEDLDKLLGLELG
FT                   ADDYVTKPFSPREVVARVKAVLRRVVLAEAPKEVLRVGPLEIDSEKVVARLGGVRLELT
FT                   PTEFRLLEALARTPGKAFSRAELLEAALPDSDALERVVDVHLKNLRRKLEAAGGAGLLE
FT                   TVRGVGYRLWTE"
     MSSTADTLDS MALVLVVEDE PEIAEILEGY LRREGFRTER ASDGRQALNL VRAARPDLVL        60
     LDIMLPEMDG LEVLRRIRSS GHTPVILVTA RTEDLDKLLG LELGADDYVT KPFSPREVVA       120
     RVKAVLRRVV LAEAPKEVLR VGPLEIDSEK VVARLGGVRL ELTPTEFRLL EALARTPGKA       180
     FSRAELLEAA LPDSDALERV VDVHLKNLRR KLEAAGGAGL LETVRGVGYR LWTE             234
//

If you have problems or comments...

PBIL Back to PBIL home page