(data stored in ACNUC7421 zone)

EMBL: CP001743.PE302

CP001743.PE302       Location/Qualifiers
FT   CDS             complement(273636..274088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0306"
FT                   /product="protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; SPTR: A3YUQ9 Protein tyrosine phosphatase; PFAM:
FT                   Protein-tyrosine phosphatase, low molecular weight; COGs:
FT                   COG0394 Protein-tyrosine-phosphatase; InterPro
FT                   IPR000106:IPR017867; KEGG: mes:Meso_3348 protein tyrosine
FT                   phosphatase; PFAM: Low molecular weight phosphotyrosine
FT                   protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27084"
FT                   /protein_id="ADD27084.1"
FT                   /translation="MTRVLFVCMGNICRSPMAEGIFRRKLRERGLEGQFEVDSCGTGGW
FT                   HAGEPADPRTQAVLSKYDAHFPHVARQVRAEDLLYFDHIFVMDRENLRTLERMFPAHRG
FT                   KARLLLDLNGGGEVPDPYYGGPQDFEAVYQMLDGALEAFFQKHTAT"
     MTRVLFVCMG NICRSPMAEG IFRRKLRERG LEGQFEVDSC GTGGWHAGEP ADPRTQAVLS        60
     KYDAHFPHVA RQVRAEDLLY FDHIFVMDRE NLRTLERMFP AHRGKARLLL DLNGGGEVPD       120
     PYYGGPQDFE AVYQMLDGAL EAFFQKHTAT                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page